SCOP 1.73: Domain d2ffyb1: 2ffy B:4-361

Lineage for d2ffyb1 (2ffy B:4-361)

1. Root: SCOP 1.73

2. Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (16 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (3 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (39 PDB entries)

8. Domain d2ffyb1: 2ffy B:4-361 [133395]
   automatically matched to d1pi4a_
   complexed with k, po4, sm3; mutant

Details for d2ffyb1

PDB Entry: 2ffy, 1.07 Å

PDB Description: ampc beta-lactamase n289a mutant in complex with a boronic acid deacylation transition state analog compound sm3

PDB Compounds: (B:) Beta-lactamase

SCOP Domain Sequences for d2ffyb1:

Sequence; same for both SEQRES and ATOM records:

>d2ffyb1 e.3.1.1 (B:4-361) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdakialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d2ffyb1:

• d2ffyb1 is new in SCOP 1.73
  
• d2ffyb1 appears in SCOP 1.75
  
• d2ffyb1 appears in the current release, SCOPe 2.08, called d2ffyb_