Lineage for d2ffsb_ (2ffs B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040331Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1040549Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1040754Family d.129.3.7: PA1206-like [143839] (1 protein)
  6. 1040755Protein Hypothetical protein PA1206 [143840] (1 species)
  7. 1040756Species Pseudomonas aeruginosa [TaxId:287] [143841] (1 PDB entry)
    Uniprot Q9I4D2 1-151
  8. 1040758Domain d2ffsb_: 2ffs B: [133392]
    automated match to d2ffsa1

Details for d2ffsb_

PDB Entry: 2ffs (more details), 2.5 Å

PDB Description: structure of pr10-allergen-like protein pa1206 from pseudomonas aeruginosa pao1
PDB Compounds: (B:) hypothetical protein PA1206

SCOPe Domain Sequences for d2ffsb_:

Sequence, based on SEQRES records: (download)

>d2ffsb_ d.129.3.7 (B:) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]}
mqfehlvqvndrtlvdlpvldrlqlweglvcrarepqyfvvglerfeilvddgdrlhrrl
ylpglvvedevvlkapdsahysikpsaevaggsldmtieepepgslfvrfayctrylqpl
gdelpydafvkqayiamdvetiatirdrf

Sequence, based on observed residues (ATOM records): (download)

>d2ffsb_ d.129.3.7 (B:) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]}
mqfehlvqvndrtdlpvldrlqlweglvcrarepqyfvvglerfeilvddgdrlhrrlyl
pglvvedevvlkapdsahysikpsaevaggsldmtieepepgslfvrfayctrylqpdel
pydafvkqayiamdvetiatirdrf

SCOPe Domain Coordinates for d2ffsb_:

Click to download the PDB-style file with coordinates for d2ffsb_.
(The format of our PDB-style files is described here.)

Timeline for d2ffsb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ffsa1