![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.7: PA1206-like [143839] (1 protein) |
![]() | Protein Hypothetical protein PA1206 [143840] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [143841] (1 PDB entry) Uniprot Q9I4D2 1-151 |
![]() | Domain d2ffsb_: 2ffs B: [133392] automated match to d2ffsa1 |
PDB Entry: 2ffs (more details), 2.5 Å
SCOPe Domain Sequences for d2ffsb_:
Sequence, based on SEQRES records: (download)
>d2ffsb_ d.129.3.7 (B:) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]} mqfehlvqvndrtlvdlpvldrlqlweglvcrarepqyfvvglerfeilvddgdrlhrrl ylpglvvedevvlkapdsahysikpsaevaggsldmtieepepgslfvrfayctrylqpl gdelpydafvkqayiamdvetiatirdrf
>d2ffsb_ d.129.3.7 (B:) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]} mqfehlvqvndrtdlpvldrlqlweglvcrarepqyfvvglerfeilvddgdrlhrrlyl pglvvedevvlkapdsahysikpsaevaggsldmtieepepgslfvrfayctrylqpdel pydafvkqayiamdvetiatirdrf
Timeline for d2ffsb_: