SCOP 1.75: Domain d2ffsb1: 2ffs B:1-149

Lineage for d2ffsb1 (2ffs B:1-149)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (10 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.7: PA1206-like [143839] (1 protein)

6. Protein Hypothetical protein PA1206 [143840] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [143841] (1 PDB entry)
   Uniprot Q9I4D2 1-151

8. Domain d2ffsb1: 2ffs B:1-149 [133392]
   automatically matched to 2FFS A:1-151

Details for d2ffsb1

PDB Entry: 2ffs, 2.5 Å

PDB Description: structure of pr10-allergen-like protein pa1206 from pseudomonas aeruginosa pao1

PDB Compounds: (B:) hypothetical protein PA1206

SCOP Domain Sequences for d2ffsb1:

Sequence, based on SEQRES records:

>d2ffsb1 d.129.3.7 (B:1-149) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]}
mqfehlvqvndrtlvdlpvldrlqlweglvcrarepqyfvvglerfeilvddgdrlhrrl
ylpglvvedevvlkapdsahysikpsaevaggsldmtieepepgslfvrfayctrylqpl
gdelpydafvkqayiamdvetiatirdrf

Sequence, based on observed residues (ATOM records):

>d2ffsb1 d.129.3.7 (B:1-149) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]}
mqfehlvqvndrtdlpvldrlqlweglvcrarepqyfvvglerfeilvddgdrlhrrlyl
pglvvedevvlkapdsahysikpsaevaggsldmtieepepgslfvrfayctrylqpdel
pydafvkqayiamdvetiatirdrf

Timeline for d2ffsb1:

• d2ffsb1 first appeared in SCOP 1.73
  
• d2ffsb1 is called d2ffsb_ in SCOPe 2.01
  
• d2ffsb1 appears in the current release, SCOPe 2.08, called d2ffsb_