Lineage for d2ffsa1 (2ffs A:1-151)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872515Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 872733Superfamily d.129.3: Bet v1-like [55961] (10 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 872925Family d.129.3.7: PA1206-like [143839] (1 protein)
  6. 872926Protein Hypothetical protein PA1206 [143840] (1 species)
  7. 872927Species Pseudomonas aeruginosa [TaxId:287] [143841] (1 PDB entry)
    Uniprot Q9I4D2 1-151
  8. 872928Domain d2ffsa1: 2ffs A:1-151 [133391]

Details for d2ffsa1

PDB Entry: 2ffs (more details), 2.5 Å

PDB Description: structure of pr10-allergen-like protein pa1206 from pseudomonas aeruginosa pao1
PDB Compounds: (A:) hypothetical protein PA1206

SCOP Domain Sequences for d2ffsa1:

Sequence, based on SEQRES records: (download)

>d2ffsa1 d.129.3.7 (A:1-151) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]}
mqfehlvqvndrtlvdlpvldrlqlweglvcrarepqyfvvglerfeilvddgdrlhrrl
ylpglvvedevvlkapdsahysikpsaevaggsldmtieepepgslfvrfayctrylqpl
gdelpydafvkqayiamdvetiatirdrfga

Sequence, based on observed residues (ATOM records): (download)

>d2ffsa1 d.129.3.7 (A:1-151) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]}
mqfehlvqvndrtlpvldrlqlweglvcrarepqyfvvglerfeilvddgdrlhrrlylp
glvvedevvlkapdsahysikpsaevaggsldmtieepepgslfvrfayctrylqpdelp
ydafvkqayiamdvetiatirdrfga

SCOP Domain Coordinates for d2ffsa1:

Click to download the PDB-style file with coordinates for d2ffsa1.
(The format of our PDB-style files is described here.)

Timeline for d2ffsa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ffsb1