SCOP 1.73: Domain d2ffsa1: 2ffs A:1-151

Lineage for d2ffsa1 (2ffs A:1-151)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.129: TBP-like [55944] (10 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (7 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.7: PA1206-like [143839] (1 protein)

6. Protein Hypothetical protein PA1206 [143840] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [143841] (1 PDB entry)

8. Domain d2ffsa1: 2ffs A:1-151 [133391]

Details for d2ffsa1

PDB Entry: 2ffs, 2.5 Å

PDB Description: structure of pr10-allergen-like protein pa1206 from pseudomonas aeruginosa pao1

PDB Compounds: (A:) hypothetical protein PA1206

SCOP Domain Sequences for d2ffsa1:

Sequence, based on SEQRES records:

>d2ffsa1 d.129.3.7 (A:1-151) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]}
mqfehlvqvndrtlvdlpvldrlqlweglvcrarepqyfvvglerfeilvddgdrlhrrl
ylpglvvedevvlkapdsahysikpsaevaggsldmtieepepgslfvrfayctrylqpl
gdelpydafvkqayiamdvetiatirdrfga

Sequence, based on observed residues (ATOM records):

>d2ffsa1 d.129.3.7 (A:1-151) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]}
mqfehlvqvndrtlpvldrlqlweglvcrarepqyfvvglerfeilvddgdrlhrrlylp
glvvedevvlkapdsahysikpsaevaggsldmtieepepgslfvrfayctrylqpdelp
ydafvkqayiamdvetiatirdrfga

Timeline for d2ffsa1:

• d2ffsa1 is new in SCOP 1.73
  
• d2ffsa1 appears in SCOP 1.75
  
• d2ffsa1 appears in the current release, SCOPe 2.08