Lineage for d2ffna1 (2ffn A:1-107)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778525Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 778526Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 778527Family a.138.1.1: Cytochrome c3-like [48696] (4 proteins)
  6. 778536Protein Cytochrome c3 [48697] (7 species)
    contains four heme groups
  7. 778560Species Desulfovibrio vulgaris [TaxId:881] [48699] (11 PDB entries)
    Uniprot P00132
  8. 778566Domain d2ffna1: 2ffn A:1-107 [133390]
    automatically matched to d1it1a_
    complexed with hem; mutant

Details for d2ffna1

PDB Entry: 2ffn (more details), 1.8 Å

PDB Description: The E41Q mutant of tetraheme cytochrome c3 from Desulfovibrio Vulgaris Miyazaki F
PDB Compounds: (A:) cytochrome c3

SCOP Domain Sequences for d2ffna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ffna1 a.138.1.1 (A:1-107) Cytochrome c3 {Desulfovibrio vulgaris [TaxId: 881]}
apkapadglkmdktkqpvvfnhsthkavkcgdchhpvngkedyqkcatagchdnmdkkdk
sakgyyhamhdkgtkfkscvgchletagadaakkkeltgckgskchs

SCOP Domain Coordinates for d2ffna1:

Click to download the PDB-style file with coordinates for d2ffna1.
(The format of our PDB-style files is described here.)

Timeline for d2ffna1: