SCOPe 2.08: Domain d2ff3b1: 2ff3 B:6-146

Lineage for d2ff3b1 (2ff3 B:6-146)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (10 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d2ff3b1: 2ff3 B:6-146 [133365]
   Other proteins in same PDB: d2ff3a_
   automated match to d1qz5a1
   complexed with atp, ca

Details for d2ff3b1

PDB Entry: 2ff3, 2 Å

PDB Description: Crystal structure of Gelsolin domain 1:N-wasp V2 motif hybrid in complex with actin

PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d2ff3b1:

Sequence, based on SEQRES records:

>d2ff3b1 c.55.1.1 (B:6-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
talvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgil
tlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfe
tfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d2ff3b1 c.55.1.1 (B:6-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
talvcdngsglvkagfagddapravfpsivgrpdsyvgdeaqskrgiltlkypiehgiit
nwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyvaiq
avlslyasg

Timeline for d2ff3b1:

• d2ff3b1 first appeared in SCOP 1.73
  
• d2ff3b1 appears in SCOPe 2.07