Lineage for d2feub1 (2feu B:10-414)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 774742Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 774743Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 774744Family a.104.1.1: Cytochrome P450 [48265] (22 proteins)
  6. 774852Protein Cytochrome P450-CAM [48266] (1 species)
  7. 774853Species Pseudomonas putida [TaxId:303] [48267] (60 PDB entries)
    Uniprot P00183
  8. 774877Domain d2feub1: 2feu B:10-414 [133353]
    automatically matched to d1p2ya_
    complexed with cam, k, mnr, trs

Details for d2feub1

PDB Entry: 2feu (more details), 1.7 Å

PDB Description: p450cam from pseudomonas putida reconstituted with manganic protoporphyrin ix
PDB Compounds: (B:) Cytochrome P450-cam

SCOP Domain Sequences for d2feub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2feub1 a.104.1.1 (B:10-414) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d2feub1:

Click to download the PDB-style file with coordinates for d2feub1.
(The format of our PDB-style files is described here.)

Timeline for d2feub1: