Lineage for d2feeb1 (2fee B:18-458)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745392Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 745393Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 745394Family f.20.1.1: Clc chloride channel [69912] (1 protein)
    duplication: consist of two similar structural parts
  6. 745395Protein Clc chloride channel [69913] (2 species)
  7. 745396Species Escherichia coli [TaxId:562] [69914] (9 PDB entries)
  8. 745418Domain d2feeb1: 2fee B:18-458 [133338]
    Other proteins in same PDB: d2feel1, d2feel2, d2feeo1, d2feeo2
    automatically matched to d1kpka_

Details for d2feeb1

PDB Entry: 2fee (more details), 3.2 Å

PDB Description: Structure of the Cl-/H+ exchanger CLC-ec1 from E.Coli in NaBr
PDB Compounds: (B:) H(+)/Cl(-) exchange transporter clcA

SCOP Domain Sequences for d2feeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2feeb1 f.20.1.1 (B:18-458) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
tlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
ftggkplysailartlakqea

SCOP Domain Coordinates for d2feeb1:

Click to download the PDB-style file with coordinates for d2feeb1.
(The format of our PDB-style files is described here.)

Timeline for d2feeb1: