SCOPe 2.04: Domain d2fedf2: 2fed F:107-210

Lineage for d2fedf2 (2fed F:107-210)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d2fedf2: 2fed F:107-210 [133336]
   Other proteins in same PDB: d2feda1, d2fedb1, d2fedd1, d2fedf1
   automatically matched to d1dqdl2
   mutant

Details for d2fedf2

PDB Entry: 2fed, 3.32 Å

PDB Description: structure of the e203q mutant of the cl-/h+ exchanger clc-ec1 from e.coli

PDB Compounds: (F:) Fab fragment, light chain

SCOPe Domain Sequences for d2fedf2:

Sequence; same for both SEQRES and ATOM records:

>d2fedf2 b.1.1.2 (F:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d2fedf2:

• d2fedf2 first appeared in SCOP 1.73
  
• d2fedf2 appears in SCOPe 2.03
  
• d2fedf2 appears in SCOPe 2.05
  
• d2fedf2 appears in the current release, SCOPe 2.08