SCOPe 2.08: Domain d2fdcb2: 2fdc B:415-593

Lineage for d2fdcb2 (2fdc B:415-593)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Nucleotide excision repair enzyme UvrB, C-terminal domain [418969] (2 species)
7. Species Bacillus caldotenax [TaxId:1395] [419431] (4 PDB entries)
   Uniprot P56981

8. Domain d2fdcb2: 2fdc B:415-593 [133305]
   Other proteins in same PDB: d2fdca1, d2fdcb1
   automatically matched to d1d9xa2
   protein/DNA complex; complexed with flq

Details for d2fdcb2

PDB Entry: 2fdc, 3.3 Å

PDB Description: structural basis of dna damage recognition and processing by uvrb: crystal structure of a uvrb/dna complex

PDB Compounds: (B:) UvrABC system protein B

SCOPe Domain Sequences for d2fdcb2:

Sequence, based on SEQRES records:

>d2fdcb2 c.37.1.19 (B:415-593) Nucleotide excision repair enzyme UvrB, C-terminal domain {Bacillus caldotenax [TaxId: 1395]}
tglldptidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvay
lhseiktlerieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersl
iqtigraarnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeir

Sequence, based on observed residues (ATOM records):

>d2fdcb2 c.37.1.19 (B:415-593) Nucleotide excision repair enzyme UvrB, C-terminal domain {Bacillus caldotenax [TaxId: 1395]}
tglldptidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvay
lhieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersliqtigraa
rnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeir

Timeline for d2fdcb2:

• d2fdcb2 first appeared in SCOP 1.73
  
• d2fdcb2 appears in SCOPe 2.07