Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Fibroblast growth factor receptor, FGFR [49179] (4 species) |
Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (11 PDB entries) |
Domain d2fdbr2: 2fdb R:3251-3360 [133301] Other proteins in same PDB: d2fdbm1, d2fdbn_ automated match to d1ev2g2 |
PDB Entry: 2fdb (more details), 2.28 Å
SCOPe Domain Sequences for d2fdbr2:
Sequence, based on SEQRES records: (download)
>d2fdbr2 b.1.1.4 (R:3251-3360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} rsrhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvl
>d2fdbr2 b.1.1.4 (R:3251-3360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} rsrhrpilqaglpanastvvggdvefvckvysdaqphiqwikhvylkvlkaagvievlyi rnvtfedageytclagnsigisfhsawltvl
Timeline for d2fdbr2:
View in 3D Domains from other chains: (mouse over for more information) d2fdbm1, d2fdbn_, d2fdbp1, d2fdbp2 |