SCOPe 2.01: Domain d2fdbp1: 2fdb P:2153-2251

Lineage for d2fdbp1 (2fdb P:2153-2251)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)

7. Species Human (Homo sapiens), FGFR1 [TaxId:9606] [49180] (4 PDB entries)

8. Domain d2fdbp1: 2fdb P:2153-2251 [133298]
   Other proteins in same PDB: d2fdbm1, d2fdbn_
   automatically matched to d1cvsc1

Details for d2fdbp1

PDB Entry: 2fdb, 2.28 Å

PDB Description: crystal structure of fibroblast growth factor (fgf)8b in complex with fgf receptor (fgfr) 2c

PDB Compounds: (P:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d2fdbp1:

Sequence; same for both SEQRES and ATOM records:

>d2fdbp1 b.1.1.4 (P:2153-2251) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]}
apywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvrnq
hwslimesvvpsdkgnytcvveneygsinhtyhldvver

Timeline for d2fdbp1:

• d2fdbp1 first appeared in SCOP 1.73
  
• d2fdbp1 appears in SCOP 1.75
  
• d2fdbp1 appears in SCOPe 2.02
  
• d2fdbp1 appears in the current release, SCOPe 2.08