SCOPe 2.08: Domain d2fcwb1: 2fcw B:86-124

Lineage for d2fcwb1 (2fcw B:86-124)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.12: LDL receptor-like module [57423] (1 superfamily)
   disulfide-rich calcium-binding fold

4. Superfamily g.12.1: LDL receptor-like module [57424] (2 families)

5. Family g.12.1.1: LDL receptor-like module [57425] (6 proteins)

6. Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57427] (14 PDB entries)
   Uniprot P01130 272-353

8. Domain d2fcwb1: 2fcw B:86-124 [133289]
   Other proteins in same PDB: d2fcwa1
   automated match to d1n7da6
   complexed with ca, mpd, na

Details for d2fcwb1

PDB Entry: 2fcw, 1.26 Å

PDB Description: structure of a complex between the pair of the ldl receptor ligand- binding modules 3-4 and the receptor associated protein (rap).

PDB Compounds: (B:) low-density lipoprotein receptor

SCOPe Domain Sequences for d2fcwb1:

Sequence; same for both SEQRES and ATOM records:

>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}
ktcsqaefrchdgkcisrqfvcdsdrdcldgsdeascpv

Timeline for d2fcwb1:

• d2fcwb1 first appeared in SCOP 1.73
  
• d2fcwb1 appears in SCOPe 2.07