Lineage for d2fcia1 (2fci A:1-105)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1661863Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1661864Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1661865Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1662180Protein Phospholipase C-gamma-1 [55577] (2 species)
  7. 1662181Species Cow (Bos taurus) [TaxId:9913] [55578] (3 PDB entries)
  8. 1662182Domain d2fcia1: 2fci A:1-105 [133268]
    automatically matched to d2plda_

Details for d2fcia1

PDB Entry: 2fci (more details)

PDB Description: Structural basis for the requirement of two phosphotyrosines in signaling mediated by Syk tyrosine kinase
PDB Compounds: (A:) C-termainl SH2 domain from phospholipase C-gamma-1 comprising residues 663-759

SCOPe Domain Sequences for d2fcia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]}
gspgiheskewyhasltraqaehmlmrvprdgaflvrkrnepnsyaisfraegkikhcrv
qqegqtvmlgnsefdslvdlisyyekhplyrkmklrypineenss

SCOPe Domain Coordinates for d2fcia1:

Click to download the PDB-style file with coordinates for d2fcia1.
(The format of our PDB-style files is described here.)

Timeline for d2fcia1: