Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Phospholipase C-gamma-1 [55577] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [55578] (3 PDB entries) |
Domain d2fcia1: 2fci A:1-105 [133268] automatically matched to d2plda_ |
PDB Entry: 2fci (more details)
SCOPe Domain Sequences for d2fcia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} gspgiheskewyhasltraqaehmlmrvprdgaflvrkrnepnsyaisfraegkikhcrv qqegqtvmlgnsefdslvdlisyyekhplyrkmklrypineenss
Timeline for d2fcia1: