Lineage for d2fcea1 (2fce A:84-144)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087624Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1087625Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1087980Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1088032Protein Calmodulin [47516] (11 species)
  7. 1088053Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89052] (4 PDB entries)
  8. 1088054Domain d2fcea1: 2fce A:84-144 [133266]
    automatically matched to d1cmf__

Details for d2fcea1

PDB Entry: 2fce (more details)

PDB Description: solution structure of c-lobe myosin light chain from saccharomices cerevisiae
PDB Compounds: (A:) myosin light chain 1

SCOPe Domain Sequences for d2fcea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
edfvkafqvfdkestgkvsvgdlrymltglgekltdaevdellkgvevdsngeidykkfi
e

SCOPe Domain Coordinates for d2fcea1:

Click to download the PDB-style file with coordinates for d2fcea1.
(The format of our PDB-style files is described here.)

Timeline for d2fcea1: