Lineage for d2fazb_ (2faz B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1638517Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1638518Protein automated matches [190233] (10 species)
    not a true protein
  7. 1638535Species Human (Homo sapiens) [TaxId:9606] [187090] (41 PDB entries)
  8. 1638548Domain d2fazb_: 2faz B: [133224]
    Other proteins in same PDB: d2faza1
    automated match to d1c3ta_

Details for d2fazb_

PDB Entry: 2faz (more details), 2 Å

PDB Description: Ubiquitin-Like Domain of Human Nuclear Zinc Finger Protein NP95
PDB Compounds: (B:) Ubiquitin-like containing PHD and RING finger domains protein 1

SCOPe Domain Sequences for d2fazb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fazb_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsmwiqvrtmdgrqthtvdslsrltkveelrrkiqelfhvepglqrlfyrgkqmedghtl
fdyevrlndtiqll

SCOPe Domain Coordinates for d2fazb_:

Click to download the PDB-style file with coordinates for d2fazb_.
(The format of our PDB-style files is described here.)

Timeline for d2fazb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2faza1