Lineage for d2fakq_ (2fak Q:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1934686Protein Proteasome alpha subunit (non-catalytic) [56255] (7 species)
    contains an extension to the common fold at the N-terminus
  7. 1934702Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (76 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1935000Domain d2fakq_: 2fak Q: [133213]
    Other proteins in same PDB: d2fak1_, d2fak2_, d2fakd_, d2fakg_, d2fakh_, d2faki_, d2fakj_, d2fakk_, d2fakl_, d2fakm_, d2fakn_, d2fakr_, d2faku_, d2fakv_, d2fakw_, d2fakx_, d2faky_, d2fakz_
    automated match to d1g65c_
    complexed with sa1

Details for d2fakq_

PDB Entry: 2fak (more details), 2.8 Å

PDB Description: Crystal structure of Salinosporamide A in complex with the yeast 20S proteasome
PDB Compounds: (Q:) Proteasome component PRE6

SCOPe Domain Sequences for d2fakq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fakq_ d.153.1.4 (Q:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
q

SCOPe Domain Coordinates for d2fakq_:

Click to download the PDB-style file with coordinates for d2fakq_.
(The format of our PDB-style files is described here.)

Timeline for d2fakq_: