Lineage for d2fakg1 (2fak G:6-240)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875596Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 875597Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 875747Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 875859Protein Proteasome alpha subunit (non-catalytic) [56255] (5 species)
    contains an extension to the common fold at the N-terminus
  7. 875939Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (12 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 876028Domain d2fakg1: 2fak G:6-240 [133203]
    Other proteins in same PDB: d2fak11, d2fak21, d2fakh1, d2faki1, d2fakj1, d2fakk1, d2fakl1, d2fakm1, d2fakn1, d2fakv1, d2fakw1, d2fakx1, d2faky1, d2fakz1
    automatically matched to d1g65g_
    complexed with sa1

Details for d2fakg1

PDB Entry: 2fak (more details), 2.8 Å

PDB Description: Crystal structure of Salinosporamide A in complex with the yeast 20S proteasome
PDB Compounds: (G:) Proteasome component C7-alpha

SCOP Domain Sequences for d2fakg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fakg1 d.153.1.4 (G:6-240) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOP Domain Coordinates for d2fakg1:

Click to download the PDB-style file with coordinates for d2fakg1.
(The format of our PDB-style files is described here.)

Timeline for d2fakg1: