Lineage for d2fakg_ (2fak G:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552712Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2552848Domain d2fakg_: 2fak G: [133203]
    Other proteins in same PDB: d2fak1_, d2fak2_, d2faka_, d2fakb_, d2fakc_, d2fakd_, d2fake_, d2fakf_, d2fakh_, d2faki_, d2fakj_, d2fakk_, d2fakl_, d2fakm_, d2fakn_, d2fako_, d2fakp_, d2fakq_, d2fakr_, d2faks_, d2fakt_, d2fakv_, d2fakw_, d2fakx_, d2faky_, d2fakz_
    automated match to d1g65g_
    complexed with sa1

Details for d2fakg_

PDB Entry: 2fak (more details), 2.8 Å

PDB Description: Crystal structure of Salinosporamide A in complex with the yeast 20S proteasome
PDB Compounds: (G:) Proteasome component C7-alpha

SCOPe Domain Sequences for d2fakg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fakg_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d2fakg_:

Click to download the PDB-style file with coordinates for d2fakg_.
(The format of our PDB-style files is described here.)

Timeline for d2fakg_: