Lineage for d2f9la1 (2f9l A:8-182)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1363362Protein Rab11b [142237] (1 species)
  7. 1363363Species Human (Homo sapiens) [TaxId:9606] [142238] (2 PDB entries)
    Uniprot Q15907 7-181
  8. 1363364Domain d2f9la1: 2f9l A:8-182 [133166]
    complexed with gdp, mg

Details for d2f9la1

PDB Entry: 2f9l (more details), 1.55 Å

PDB Description: 3d structure of inactive human rab11b gtpase
PDB Compounds: (A:) RAB11B, member RAS oncogene family

SCOPe Domain Sequences for d2f9la1:

Sequence, based on SEQRES records: (download)

>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]}
ydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwdt
agqeryrritsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksd
lrhlravptdearafaeknnlsfietsaldstnveeafknilteiyrivsqkqia

Sequence, based on observed residues (ATOM records): (download)

>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]}
ydylfkvvligdsgvgksnllsrftrnefnlstigvefatrsiqvdgktikaqiwdtagq
eryrritsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksdlrh
lravptdearafaeknnlsfietsaldstnveeafknilteiyrivsqkqia

SCOPe Domain Coordinates for d2f9la1:

Click to download the PDB-style file with coordinates for d2f9la1.
(The format of our PDB-style files is described here.)

Timeline for d2f9la1: