Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein Pre-mRNA branch site protein p14 [143316] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143317] (2 PDB entries) Uniprot Q9Y3B4 12-125 |
Domain d2f9db_: 2f9d B: [133160] automated match to d2f9da1 |
PDB Entry: 2f9d (more details), 2.5 Å
SCOPe Domain Sequences for d2f9db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f9db_ d.58.7.1 (B:) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} rlppevnrilyirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifdak nacdhlsgfnvcnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk
Timeline for d2f9db_: