Lineage for d2f9db_ (2f9d B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195271Protein Pre-mRNA branch site protein p14 [143316] (1 species)
  7. 2195272Species Human (Homo sapiens) [TaxId:9606] [143317] (2 PDB entries)
    Uniprot Q9Y3B4 12-125
  8. 2195274Domain d2f9db_: 2f9d B: [133160]
    automated match to d2f9da1

Details for d2f9db_

PDB Entry: 2f9d (more details), 2.5 Å

PDB Description: 2.5 angstrom resolution structure of the spliceosomal protein p14 bound to region of sf3b155
PDB Compounds: (B:) Pre-mRNA branch site protein p14

SCOPe Domain Sequences for d2f9db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f9db_ d.58.7.1 (B:) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}
rlppevnrilyirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifdak
nacdhlsgfnvcnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk

SCOPe Domain Coordinates for d2f9db_:

Click to download the PDB-style file with coordinates for d2f9db_.
(The format of our PDB-style files is described here.)

Timeline for d2f9db_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2f9da1