SCOP 1.73: Domain d2f90b1: 2f90 B:3-250

Lineage for d2f90b1 (2f90 B:3-250)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (3 proteins)

6. Protein Phosphoglycerate mutase [53256] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110656] (7 PDB entries)

8. Domain d2f90b1: 2f90 B:3-250 [133149]
   automatically matched to d1t8pa_
   complexed with 3pg, alf

Details for d2f90b1

PDB Entry: 2f90, 2 Å

PDB Description: Crystal structure of bisphosphoglycerate mutase in complex with 3-phosphoglycerate and AlF4-

PDB Compounds: (B:) Bisphosphoglycerate mutase

SCOP Domain Sequences for d2f90b1:

Sequence; same for both SEQRES and ATOM records:

>d2f90b1 c.60.1.1 (B:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]}
kyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvlnr
sihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsynvt
pppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrgkt
ilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqeaiq
aaikkved

Timeline for d2f90b1:

• d2f90b1 is new in SCOP 1.73
  
• d2f90b1 appears in SCOP 1.75
  
• d2f90b1 appears in the current release, SCOPe 2.08, called d2f90b_