Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H3 [47122] (5 species) |
Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (7 PDB entries) Uniprot P84229 |
Domain d2f8ne1: 2f8n E:641-735 [133136] Other proteins in same PDB: d2f8nb1, d2f8nd1, d2f8nf1, d2f8ng1, d2f8nh1, d2f8nk1 automatically matched to d1eqzc_ |
PDB Entry: 2f8n (more details), 2.9 Å
SCOP Domain Sequences for d2f8ne1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f8ne1 a.22.1.1 (E:641-735) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} yrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeaseayl vglfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d2f8ne1: