Lineage for d2f8ne1 (2f8n E:641-735)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764835Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 764836Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 764837Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 764992Protein Histone H3 [47122] (5 species)
  7. 765051Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (7 PDB entries)
    Uniprot P84229
  8. 765061Domain d2f8ne1: 2f8n E:641-735 [133136]
    Other proteins in same PDB: d2f8nb1, d2f8nd1, d2f8nf1, d2f8ng1, d2f8nh1, d2f8nk1
    automatically matched to d1eqzc_

Details for d2f8ne1

PDB Entry: 2f8n (more details), 2.9 Å

PDB Description: 2.9 Angstrom X-ray structure of hybrid macroH2A nucleosomes
PDB Compounds: (E:) Histone H3.1

SCOP Domain Sequences for d2f8ne1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8ne1 a.22.1.1 (E:641-735) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
yrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeaseayl
vglfedtnlcaihakrvtimpkdiqlarrirgera

SCOP Domain Coordinates for d2f8ne1:

Click to download the PDB-style file with coordinates for d2f8ne1.
(The format of our PDB-style files is described here.)

Timeline for d2f8ne1: