Lineage for d2f8nd1 (2f8n D:1230-1322)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764835Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 764836Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 764837Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 764911Protein Histone H2B [47119] (6 species)
  7. 764983Species Mouse (Mus musculus), H2Ba [TaxId:10090] [140393] (2 PDB entries)
    Uniprot Q9D2U9 34-126
  8. 764986Domain d2f8nd1: 2f8n D:1230-1322 [133135]
    Other proteins in same PDB: d2f8na1, d2f8nb1, d2f8ne1, d2f8nf1, d2f8ng1, d2f8nk1
    automatically matched to 1U35 D:1230-1322

Details for d2f8nd1

PDB Entry: 2f8n (more details), 2.9 Å

PDB Description: 2.9 Angstrom X-ray structure of hybrid macroH2A nucleosomes
PDB Compounds: (D:) Histone 3, H2ba

SCOP Domain Sequences for d2f8nd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8nd1 a.22.1.1 (D:1230-1322) Histone H2B {Mouse (Mus musculus), H2Ba [TaxId: 10090]}
rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiaseasrlahynkrstitsr
evqtavrlllpgelakhavsegtkavtkytssk

SCOP Domain Coordinates for d2f8nd1:

Click to download the PDB-style file with coordinates for d2f8nd1.
(The format of our PDB-style files is described here.)

Timeline for d2f8nd1: