SCOPe 2.06: Domain d2f74a2: 2f74 A:3-180

Lineage for d2f74a2 (2f74 A:3-180)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (23 PDB entries)

8. Domain d2f74a2: 2f74 A:3-180 [133080]
   Other proteins in same PDB: d2f74a1, d2f74b2, d2f74b3, d2f74d1, d2f74e_
   automatically matched to d1ddha2

Details for d2f74a2

PDB Entry: 2f74, 2.7 Å

PDB Description: murine mhc class i h-2db in complex with human b2-microglobulin and lcmv-derived immunodminant peptide gp33

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d2f74a2:

Sequence; same for both SEQRES and ATOM records:

>d2f74a2 d.19.1.1 (A:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywer
etqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrd
yialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll

Timeline for d2f74a2:

• d2f74a2 first appeared in SCOP 1.73
  
• d2f74a2 appears in SCOPe 2.05
  
• d2f74a2 appears in SCOPe 2.07
  
• d2f74a2 appears in the current release, SCOPe 2.08