Lineage for d2f74a2 (2f74 A:3-180)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1020887Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1021164Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (21 PDB entries)
  8. 1021192Domain d2f74a2: 2f74 A:3-180 [133080]
    Other proteins in same PDB: d2f74a1, d2f74b_, d2f74d1, d2f74e_
    automatically matched to d1ddha2

Details for d2f74a2

PDB Entry: 2f74 (more details), 2.7 Å

PDB Description: murine mhc class i h-2db in complex with human b2-microglobulin and lcmv-derived immunodminant peptide gp33
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d2f74a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f74a2 d.19.1.1 (A:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywer
etqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrd
yialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll

SCOPe Domain Coordinates for d2f74a2:

Click to download the PDB-style file with coordinates for d2f74a2.
(The format of our PDB-style files is described here.)

Timeline for d2f74a2: