SCOP 1.75: Domain d2f6mc1: 2f6m C:322-383

Lineage for d2f6mc1 (2f6m C:322-383)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (3 families)
   forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin

5. Family a.2.17.1: VPS23 C-terminal domain [140112] (1 protein)

6. Protein Vacuolar protein sorting-associated protein 23, VPS23 [140113] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140114] (3 PDB entries)
   Uniprot P25604 322-385! Uniprot P25604 325-383

8. Domain d2f6mc1: 2f6m C:322-383 [133053]
   Other proteins in same PDB: d2f6mb1, d2f6md1
   automatically matched to 2F66 A:322-385
   complexed with ddq, mg; mutant

Details for d2f6mc1

PDB Entry: 2f6m, 2.1 Å

PDB Description: structure of a vps23-c:vps28-n subcomplex

PDB Compounds: (C:) suppressor protein stp22 of temperature-sensitive alpha-factor receptor and arginine permease

SCOP Domain Sequences for d2f6mc1:

Sequence; same for both SEQRES and ATOM records:

>d2f6mc1 a.2.17.1 (C:322-383) Vacuolar protein sorting-associated protein 23, VPS23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tdglnqlynlvaqdyaltdtiealsrmlhrgtipldtfvkqgrelarqqflvrwhiqrit
sp

Timeline for d2f6mc1:

• d2f6mc1 first appeared in SCOP 1.73
  
• d2f6mc1 is called d2f6mc_ in SCOPe 2.01
  
• d2f6mc1 appears in the current release, SCOPe 2.08, called d2f6mc2