Class a: All alpha proteins [46456] (284 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (3 families) forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin |
Family a.2.17.1: VPS23 C-terminal domain [140112] (1 protein) |
Protein Vacuolar protein sorting-associated protein 23, VPS23 [140113] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140114] (3 PDB entries) Uniprot P25604 322-385! Uniprot P25604 325-383 |
Domain d2f6mc1: 2f6m C:322-383 [133053] Other proteins in same PDB: d2f6mb1, d2f6md1 automatically matched to 2F66 A:322-385 complexed with ddq, mg; mutant |
PDB Entry: 2f6m (more details), 2.1 Å
SCOP Domain Sequences for d2f6mc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f6mc1 a.2.17.1 (C:322-383) Vacuolar protein sorting-associated protein 23, VPS23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tdglnqlynlvaqdyaltdtiealsrmlhrgtipldtfvkqgrelarqqflvrwhiqrit sp
Timeline for d2f6mc1: