Lineage for d2f6ma_ (2f6m A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904111Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 904644Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (3 families) (S)
    forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin
  5. 904645Family a.2.17.1: VPS23 C-terminal domain [140112] (1 protein)
  6. 904646Protein Vacuolar protein sorting-associated protein 23, VPS23 [140113] (1 species)
  7. 904647Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140114] (3 PDB entries)
    Uniprot P25604 322-385! Uniprot P25604 325-383
  8. 904648Domain d2f6ma_: 2f6m A: [133051]
    Other proteins in same PDB: d2f6mb_, d2f6md_
    automated match to d2f66a1
    complexed with ddq, mg

Details for d2f6ma_

PDB Entry: 2f6m (more details), 2.1 Å

PDB Description: Structure of a Vps23-C:Vps28-N subcomplex
PDB Compounds: (A:) suppressor protein stp22 of temperature-sensitive alpha-factor receptor and arginine permease

SCOPe Domain Sequences for d2f6ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f6ma_ a.2.17.1 (A:) Vacuolar protein sorting-associated protein 23, VPS23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtdglnqlynlvaqdyaltdtiealsrmlhrgtipldtfvkqgrelarqqflvrwhiqri
tspls

SCOPe Domain Coordinates for d2f6ma_:

Click to download the PDB-style file with coordinates for d2f6ma_.
(The format of our PDB-style files is described here.)

Timeline for d2f6ma_: