SCOPe 2.01: Domain d2f6la1: 2f6l A:34-199

Lineage for d2f6la1 (2f6l A:34-199)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
   multihelical; core: 6 helices, bundle

4. Superfamily a.130.1: Chorismate mutase II [48600] (4 families)

5. Family a.130.1.4: Secreted chorismate mutase-like [140945] (1 protein)
   duplication; two structural repeats, like in the yeast enzyme, but with a different location of the remaining active site

6. Protein Secreted chorismate mutase [140946] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [140947] (4 PDB entries)
   Uniprot O07746 34-199

8. Domain d2f6la1: 2f6l A:34-199 [133049]

Details for d2f6la1

PDB Entry: 2f6l, 1.7 Å

PDB Description: x-ray structure of chorismate mutase from mycobacterium tuberculosis

PDB Compounds: (A:) chorismate mutase

SCOPe Domain Sequences for d2f6la1:

Sequence; same for both SEQRES and ATOM records:

>d2f6la1 a.130.1.4 (A:34-199) Secreted chorismate mutase {Mycobacterium tuberculosis [TaxId: 1773]}
dgtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdy
vtrvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshws
llsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa

Timeline for d2f6la1:

• d2f6la1 first appeared in SCOP 1.73
  
• d2f6la1 appears in SCOP 1.75
  
• d2f6la1 appears in SCOPe 2.02
  
• d2f6la1 appears in the current release, SCOPe 2.08