Lineage for d2f6kb1 (2f6k B:2-307)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 816850Superfamily c.1.9: Metallo-dependent hydrolases [51556] (18 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 817163Family c.1.9.15: PP1699/LP2961-like [141819] (5 proteins)
    Pfam PF04909; Amidohydrolase; stand-alone domain
  6. 817178Protein Putative amidohydrolase LP2961 [141828] (1 species)
  7. 817179Species Lactobacillus plantarum [TaxId:1590] [141829] (1 PDB entry)
    Uniprot Q88TJ2 2-307
  8. 817181Domain d2f6kb1: 2f6k B:2-307 [133048]
    automatically matched to 2F6K A:2-307
    complexed with mn

Details for d2f6kb1

PDB Entry: 2f6k (more details), 2.5 Å

PDB Description: crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24
PDB Compounds: (B:) metal-dependent hydrolase

SCOP Domain Sequences for d2f6kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f6kb1 c.1.9.15 (B:2-307) Putative amidohydrolase LP2961 {Lactobacillus plantarum [TaxId: 1590]}
skidfhthylptsyvealkrhvpgdpdgwptpewtpqltlnfmrdndisysilslssphv
nfgdkaetirlveaanddgkslaqqypdqlgylaslpipyeldavktvqqaldqdgalgv
tvptnsrglyfgspvlervyqeldarqaivalhpnepailpknvdidlpvpllgffmdtt
mtfinmlkyhffekypnikviiphagaflgivddriaqyaqkvyqvdvydvmhhvyfdva
gavlprqlptlmslaqpehllygsdipytpldgsrqlghalattdlltneqkqaifydna
hrllte

SCOP Domain Coordinates for d2f6kb1:

Click to download the PDB-style file with coordinates for d2f6kb1.
(The format of our PDB-style files is described here.)

Timeline for d2f6kb1: