SCOPe 2.08: Domain d2f6kb_: 2f6k B:

Lineage for d2f6kb_ (2f6k B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.15: PP1699/LP2961-like [141819] (6 proteins)
   Pfam PF04909; Amidohydrolase; stand-alone domain

6. Protein Putative amidohydrolase LP2961 [141828] (1 species)

7. Species Lactobacillus plantarum [TaxId:1590] [141829] (1 PDB entry)
   Uniprot Q88TJ2 2-307

8. Domain d2f6kb_: 2f6k B: [133048]
   automated match to d2f6ka1
   complexed with mn

Details for d2f6kb_

PDB Entry: 2f6k, 2.5 Å

PDB Description: crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24

PDB Compounds: (B:) metal-dependent hydrolase

SCOPe Domain Sequences for d2f6kb_:

Sequence; same for both SEQRES and ATOM records:

>d2f6kb_ c.1.9.15 (B:) Putative amidohydrolase LP2961 {Lactobacillus plantarum [TaxId: 1590]}
skidfhthylptsyvealkrhvpgdpdgwptpewtpqltlnfmrdndisysilslssphv
nfgdkaetirlveaanddgkslaqqypdqlgylaslpipyeldavktvqqaldqdgalgv
tvptnsrglyfgspvlervyqeldarqaivalhpnepailpknvdidlpvpllgffmdtt
mtfinmlkyhffekypnikviiphagaflgivddriaqyaqkvyqvdvydvmhhvyfdva
gavlprqlptlmslaqpehllygsdipytpldgsrqlghalattdlltneqkqaifydna
hrllte

Timeline for d2f6kb_:

• d2f6kb_ first appeared in SCOP 1.73, called d2f6kb1
  
• d2f6kb_ appears in SCOPe 2.07