SCOPe 2.01: Domain d2f66e_: 2f66 E:

Lineage for d2f66e_ (2f66 E:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (3 families)
   forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin

5. Family a.2.17.2: VPS28 N-terminal domain [140115] (2 proteins)
   includes structurally variable linker region

6. Protein Vacuolar protein sorting-associated protein 28, VPS28 [140116] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140117] (3 PDB entries)
   Uniprot Q02767 15-125! Uniprot Q02767 23-123

8. Domain d2f66e_: 2f66 E: [133031]
   Other proteins in same PDB: d2f66a1, d2f66c1, d2f66d_, d2f66f_
   automated match to d2f66b1
   complexed with so4

Details for d2f66e_

PDB Entry: 2f66, 2.8 Å

PDB Description: structure of the escrt-i endosomal trafficking complex

PDB Compounds: (E:) vacuolar protein sorting-associated protein vps28

SCOPe Domain Sequences for d2f66e_:

Sequence; same for both SEQRES and ATOM records:

>d2f66e_ a.2.17.2 (E:) Vacuolar protein sorting-associated protein 28, VPS28 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqlfhdevplfdnsitskdkevietlseiysivitldhvekaylkdsiddtqytntvdkl
lkqfkvylnsqnkeeinkhfqsieafadtynitasnaitrlergipitaeh

Timeline for d2f66e_:

• d2f66e_ first appeared in SCOP 1.73, called d2f66e1
  
• d2f66e_ was called d2f66e1 in SCOP 1.75
  
• d2f66e_ appears in SCOPe 2.02
  
• d2f66e_ appears in the current release, SCOPe 2.08