Class a: All alpha proteins [46456] (284 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (3 families) forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin |
Family a.2.17.2: VPS28 N-terminal domain [140115] (2 proteins) includes structurally variable linker region |
Protein Vacuolar protein sorting-associated protein 28, VPS28 [140116] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140117] (3 PDB entries) Uniprot Q02767 15-125! Uniprot Q02767 23-123 |
Domain d2f66e_: 2f66 E: [133031] Other proteins in same PDB: d2f66a1, d2f66c1, d2f66d_, d2f66f_ automated match to d2f66b1 complexed with so4 |
PDB Entry: 2f66 (more details), 2.8 Å
SCOPe Domain Sequences for d2f66e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f66e_ a.2.17.2 (E:) Vacuolar protein sorting-associated protein 28, VPS28 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sqlfhdevplfdnsitskdkevietlseiysivitldhvekaylkdsiddtqytntvdkl lkqfkvylnsqnkeeinkhfqsieafadtynitasnaitrlergipitaeh
Timeline for d2f66e_: