SCOP 1.73: Domain d2f5va2: 2f5v A:355-552

Lineage for d2f5va2 (2f5v A:355-552)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)

6. Protein Pyranose 2-oxidase [117843] (1 species)

7. Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117844] (5 PDB entries)

8. Domain d2f5va2: 2f5v A:355-552 [133011]
   Other proteins in same PDB: d2f5va1
   automatically matched to d1tzla2
   complexed with fad, kbg, peg, pg4; mutant

Details for d2f5va2

PDB Entry: 2f5v, 1.41 Å

PDB Description: reaction geometry and thermostability mutant of pyranose 2-oxidase from the white-rot fungus peniophora sp.

PDB Compounds: (A:) Pyranose 2-oxidase

SCOP Domain Sequences for d2f5va2:

Sequence; same for both SEQRES and ATOM records:

>d2f5va2 d.16.1.1 (A:355-552) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}
yiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvkn
hmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrff
grtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflp
gslpqfmepglvlhlggt

Timeline for d2f5va2:

• d2f5va2 is new in SCOP 1.73
  
• d2f5va2 appears in SCOP 1.75
  
• d2f5va2 appears in the current release, SCOPe 2.08