![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
![]() | Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) ![]() |
![]() | Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
![]() | Protein Ribosomal protein S19 [54572] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries) Uniprot P80381 |
![]() | Domain d2f4vs1: 2f4v S:2-85 [132956] Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vq1, d2f4vr1, d2f4vt1 automatically matched to d1fjgs_ complexed with ab9, d2c, k, mg, zn |
PDB Entry: 2f4v (more details), 3.8 Å
SCOPe Domain Sequences for d2f4vs1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f4vs1 d.28.1.1 (S:2-85) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]} prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy itenmvghklgefaptrtyrghgk
Timeline for d2f4vs1: