SCOP 1.73: Domain d2f4vs1: 2f4v S:2-85

Lineage for d2f4vs1 (2f4v S:2-85)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
   alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123

4. Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family)

5. Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)

6. Protein Ribosomal protein S19 [54572] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)

8. Domain d2f4vs1: 2f4v S:2-85 [132956]
   Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vq1, d2f4vr1, d2f4vt1
   automatically matched to d1fjgs_
   complexed with ab9, d2c, k, mg, zn

Details for d2f4vs1

PDB Entry: 2f4v, 3.8 Å

PDB Description: 30S ribosome + designer antibiotic

PDB Compounds: (S:) 30S ribosomal protein S19

SCOP Domain Sequences for d2f4vs1:

Sequence; same for both SEQRES and ATOM records:

>d2f4vs1 d.28.1.1 (S:2-85) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyrghgk

Timeline for d2f4vs1:

• d2f4vs1 is new in SCOP 1.73
  
• d2f4vs1 appears in SCOP 1.75
  
• d2f4vs1 appears in the current release, SCOPe 2.08