Lineage for d2f4vr1 (2f4v R:16-88)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1480558Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 1480559Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 1480560Protein Ribosomal protein S18 [46913] (2 species)
  7. 1480586Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
    Uniprot P80382
  8. 1480619Domain d2f4vr1: 2f4v R:16-88 [132955]
    Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vq1, d2f4vs1, d2f4vt1
    automatically matched to d1i94r_
    complexed with ab9, d2c, k, mg, zn

Details for d2f4vr1

PDB Entry: 2f4v (more details), 3.8 Å

PDB Description: 30S ribosome + designer antibiotic
PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2f4vr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4vr1 a.4.8.1 (R:16-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOPe Domain Coordinates for d2f4vr1:

Click to download the PDB-style file with coordinates for d2f4vr1.
(The format of our PDB-style files is described here.)

Timeline for d2f4vr1: