SCOPe 2.02: Domain d2f4vq1: 2f4v Q:2-105

Lineage for d2f4vq1 (2f4v Q:2-105)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein Ribosomal protein S17 [50304] (3 species)

7. Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries)
   Uniprot P24321

8. Domain d2f4vq1: 2f4v Q:2-105 [132954]
   Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vr1, d2f4vs1, d2f4vt1
   automatically matched to d1fjgq_
   complexed with ab9, d2c, k, mg, zn

Details for d2f4vq1

PDB Entry: 2f4v, 3.8 Å

PDB Description: 30S ribosome + designer antibiotic

PDB Compounds: (Q:) 30S ribosomal protein S17

SCOPe Domain Sequences for d2f4vq1:

Sequence; same for both SEQRES and ATOM records:

>d2f4vq1 b.40.4.5 (Q:2-105) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

Timeline for d2f4vq1:

• d2f4vq1 first appeared in SCOP 1.73
  
• d2f4vq1 appears in SCOPe 2.01
  
• d2f4vq1 appears in SCOPe 2.03
  
• d2f4vq1 appears in the current release, SCOPe 2.08