Lineage for d2f4vq1 (2f4v Q:2-105)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 950107Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 950437Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 950757Protein Ribosomal protein S17 [50304] (3 species)
  7. 950787Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries)
    Uniprot P24321
  8. 950820Domain d2f4vq1: 2f4v Q:2-105 [132954]
    Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vr1, d2f4vs1, d2f4vt1
    automatically matched to d1fjgq_
    complexed with ab9, d2c, k, mg, zn

Details for d2f4vq1

PDB Entry: 2f4v (more details), 3.8 Å

PDB Description: 30S ribosome + designer antibiotic
PDB Compounds: (Q:) 30S ribosomal protein S17

SCOPe Domain Sequences for d2f4vq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4vq1 b.40.4.5 (Q:2-105) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

SCOPe Domain Coordinates for d2f4vq1:

Click to download the PDB-style file with coordinates for d2f4vq1.
(The format of our PDB-style files is described here.)

Timeline for d2f4vq1: