SCOPe 2.07: Domain d2f4vp1: 2f4v P:1-83

Lineage for d2f4vp1 (2f4v P:1-83)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
   beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234

4. Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family)

5. Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)

6. Protein Ribosomal protein S16 [54567] (3 species)

7. Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)
   Uniprot P80379

8. Domain d2f4vp1: 2f4v P:1-83 [132953]
   Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vq1, d2f4vr1, d2f4vs1, d2f4vt1
   automatically matched to d1emwa_
   complexed with ab9, d2c, k, mg, zn

Details for d2f4vp1

PDB Entry: 2f4v, 3.8 Å

PDB Description: 30S ribosome + designer antibiotic

PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d2f4vp1:

Sequence; same for both SEQRES and ATOM records:

>d2f4vp1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

Timeline for d2f4vp1:

• d2f4vp1 first appeared in SCOP 1.73
  
• d2f4vp1 appears in SCOPe 2.06
  
• d2f4vp1 appears in the current release, SCOPe 2.08