SCOPe 2.04: Domain d2f4vo1: 2f4v O:2-89

Lineage for d2f4vo1 (2f4v O:2-89)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array
4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families)

5. Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
   contains additional N-terminal helix that forms a separate unit
   automatically mapped to Pfam PF00312

6. Protein Ribosomal protein S15 [47065] (3 species)

7. Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
   Uniprot P80378

8. Domain d2f4vo1: 2f4v O:2-89 [132952]
   Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vp1, d2f4vq1, d2f4vr1, d2f4vs1, d2f4vt1
   automatically matched to d1ab3__
   complexed with ab9, d2c, k, mg, zn

Details for d2f4vo1

PDB Entry: 2f4v, 3.8 Å

PDB Description: 30S ribosome + designer antibiotic

PDB Compounds: (O:) 30S ribosomal protein S15

SCOPe Domain Sequences for d2f4vo1:

Sequence; same for both SEQRES and ATOM records:

>d2f4vo1 a.16.1.2 (O:2-89) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

Timeline for d2f4vo1:

• d2f4vo1 first appeared in SCOP 1.73
  
• d2f4vo1 appears in SCOPe 2.03
  
• d2f4vo1 appears in SCOPe 2.05
  
• d2f4vo1 appears in the current release, SCOPe 2.08