| Class g: Small proteins [56992] (85 folds) |
| Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) ![]() |
| Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein) |
| Protein Ribosomal protein S14 [57753] (1 species) |
| Species Thermus thermophilus [TaxId:274] [57754] (36 PDB entries) |
| Domain d2f4vn1: 2f4v N:2-61 [132951] Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vo1, d2f4vp1, d2f4vq1, d2f4vr1, d2f4vs1, d2f4vt1 automatically matched to d1fjgn_ complexed with ab9, d2c, k, mg, zn |
PDB Entry: 2f4v (more details), 3.8 Å
SCOP Domain Sequences for d2f4vn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f4vn1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
Timeline for d2f4vn1: