Lineage for d2f4vk1 (2f4v K:11-129)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 702503Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 702504Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 702551Protein Ribosomal protein S11 [53141] (1 species)
  7. 702552Species Thermus thermophilus [TaxId:274] [53142] (37 PDB entries)
  8. 702579Domain d2f4vk1: 2f4v K:11-129 [132948]
    Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vj1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vq1, d2f4vr1, d2f4vs1, d2f4vt1
    automatically matched to d1i94k_
    complexed with ab9, d2c, k, mg, zn

Details for d2f4vk1

PDB Entry: 2f4v (more details), 3.8 Å

PDB Description: 30S ribosome + designer antibiotic
PDB Compounds: (K:) 30S ribosomal protein S11

SCOP Domain Sequences for d2f4vk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4vk1 c.55.4.1 (K:11-129) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

SCOP Domain Coordinates for d2f4vk1:

Click to download the PDB-style file with coordinates for d2f4vk1.
(The format of our PDB-style files is described here.)

Timeline for d2f4vk1: