SCOP 1.73: Domain d2f4vk1: 2f4v K:11-129

Lineage for d2f4vk1 (2f4v K:11-129)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (2 families)

5. Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)

6. Protein Ribosomal protein S11 [53141] (1 species)

7. Species Thermus thermophilus [TaxId:274] [53142] (37 PDB entries)

8. Domain d2f4vk1: 2f4v K:11-129 [132948]
   Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vj1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vq1, d2f4vr1, d2f4vs1, d2f4vt1
   automatically matched to d1i94k_
   complexed with ab9, d2c, k, mg, zn

Details for d2f4vk1

PDB Entry: 2f4v, 3.8 Å

PDB Description: 30S ribosome + designer antibiotic

PDB Compounds: (K:) 30S ribosomal protein S11

SCOP Domain Sequences for d2f4vk1:

Sequence; same for both SEQRES and ATOM records:

>d2f4vk1 c.55.4.1 (K:11-129) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

Timeline for d2f4vk1:

• d2f4vk1 is new in SCOP 1.73
  
• d2f4vk1 appears in SCOP 1.75
  
• d2f4vk1 appears in the current release, SCOPe 2.08