SCOPe 2.04: Domain d2f4vj1: 2f4v J:3-100

Lineage for d2f4vj1 (2f4v J:3-100)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family)
   automatically mapped to Pfam PF00338

5. Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)

6. Protein Ribosomal protein S10 [55001] (2 species)

7. Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries)
   Uniprot P80375

8. Domain d2f4vj1: 2f4v J:3-100 [132947]
   Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vq1, d2f4vr1, d2f4vs1, d2f4vt1
   automatically matched to d1fjgj_
   complexed with ab9, d2c, k, mg, zn

Details for d2f4vj1

PDB Entry: 2f4v, 3.8 Å

PDB Description: 30S ribosome + designer antibiotic

PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d2f4vj1:

Sequence; same for both SEQRES and ATOM records:

>d2f4vj1 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

Timeline for d2f4vj1:

• d2f4vj1 first appeared in SCOP 1.73
  
• d2f4vj1 appears in SCOPe 2.03
  
• d2f4vj1 appears in SCOPe 2.05
  
• d2f4vj1 appears in the current release, SCOPe 2.08