SCOP 1.73: Domain d2f4vj1: 2f4v J:3-100

Lineage for d2f4vj1 (2f4v J:3-100)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family)

5. Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)

6. Protein Ribosomal protein S10 [55001] (1 species)

7. Species Thermus thermophilus [TaxId:274] [55002] (36 PDB entries)

8. Domain d2f4vj1: 2f4v J:3-100 [132947]
   Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vq1, d2f4vr1, d2f4vs1, d2f4vt1
   automatically matched to d1fjgj_
   complexed with ab9, d2c, k, mg, zn

Details for d2f4vj1

PDB Entry: 2f4v, 3.8 Å

PDB Description: 30S ribosome + designer antibiotic

PDB Compounds: (J:) 30S ribosomal protein S10

SCOP Domain Sequences for d2f4vj1:

Sequence; same for both SEQRES and ATOM records:

>d2f4vj1 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

Timeline for d2f4vj1:

• d2f4vj1 is new in SCOP 1.73
  
• d2f4vj1 appears in SCOP 1.75
  
• d2f4vj1 appears in the current release, SCOPe 2.08