SCOP 1.73: Domain d2f4vh1: 2f4v H:1-138

Lineage for d2f4vh1 (2f4v H:1-138)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
   consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a

4. Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family)

5. Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)

6. Protein Ribosomal protein S8 [56049] (4 species)

7. Species Thermus thermophilus [TaxId:274] [56051] (37 PDB entries)

8. Domain d2f4vh1: 2f4v H:1-138 [132945]
   Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vi1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vq1, d2f4vr1, d2f4vs1, d2f4vt1
   automatically matched to d1fjgh_
   complexed with ab9, d2c, k, mg, zn

Details for d2f4vh1

PDB Entry: 2f4v, 3.8 Å

PDB Description: 30S ribosome + designer antibiotic

PDB Compounds: (H:) 30S ribosomal protein S8

SCOP Domain Sequences for d2f4vh1:

Sequence; same for both SEQRES and ATOM records:

>d2f4vh1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

Timeline for d2f4vh1:

• d2f4vh1 is new in SCOP 1.73
  
• d2f4vh1 appears in SCOP 1.75
  
• d2f4vh1 appears in the current release, SCOPe 2.08