SCOPe 2.03: Domain d2f4vg1: 2f4v G:2-156

Lineage for d2f4vg1 (2f4v G:2-156)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
   core: 5 helices; contains one more helix and a beta-hairpin outside the core

4. Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family)

5. Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)

6. Protein Ribosomal protein S7 [47975] (4 species)

7. Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
   Uniprot P17291

8. Domain d2f4vg1: 2f4v G:2-156 [132944]
   Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vh1, d2f4vi1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vq1, d2f4vr1, d2f4vs1, d2f4vt1
   automatically matched to d1fjgg_
   complexed with ab9, d2c, k, mg, zn

Details for d2f4vg1

PDB Entry: 2f4v, 3.8 Å

PDB Description: 30S ribosome + designer antibiotic

PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d2f4vg1:

Sequence; same for both SEQRES and ATOM records:

>d2f4vg1 a.75.1.1 (G:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

Timeline for d2f4vg1:

• d2f4vg1 first appeared in SCOP 1.73
  
• d2f4vg1 appears in SCOPe 2.02
  
• d2f4vg1 appears in SCOPe 2.04
  
• d2f4vg1 appears in the current release, SCOPe 2.08