Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily) alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143 |
Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) automatically mapped to Pfam PF00189 |
Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein) |
Protein Ribosomal protein S3 C-terminal domain [54823] (2 species) |
Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries) Uniprot P80372 |
Domain d2f4vc2: 2f4v C:107-207 [132939] Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vq1, d2f4vr1, d2f4vs1, d2f4vt1 automatically matched to d1fjgc2 complexed with ab9, d2c, k, mg, zn |
PDB Entry: 2f4v (more details), 3.8 Å
SCOPe Domain Sequences for d2f4vc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f4vc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]} qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte waaqgrvplhtlranidygfalarttygvlgvkayiflgev
Timeline for d2f4vc2: