Lineage for d2f4vc2 (2f4v C:107-207)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860387Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 860388Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
  5. 860389Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 860390Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 860416Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
    Uniprot P80372
  8. 860444Domain d2f4vc2: 2f4v C:107-207 [132939]
    Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vq1, d2f4vr1, d2f4vs1, d2f4vt1
    automatically matched to d1fjgc2
    complexed with ab9, d2c, k, mg, zn

Details for d2f4vc2

PDB Entry: 2f4v (more details), 3.8 Å

PDB Description: 30S ribosome + designer antibiotic
PDB Compounds: (C:) 30S ribosomal protein S3

SCOP Domain Sequences for d2f4vc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4vc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOP Domain Coordinates for d2f4vc2:

Click to download the PDB-style file with coordinates for d2f4vc2.
(The format of our PDB-style files is described here.)

Timeline for d2f4vc2: