SCOPe 2.03: Domain d2f4vc1: 2f4v C:2-106

Lineage for d2f4vc1 (2f4v C:2-106)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)

7. Species Thermus thermophilus [TaxId:274] [54817] (36 PDB entries)
   Uniprot P80372

8. Domain d2f4vc1: 2f4v C:2-106 [132938]
   Other proteins in same PDB: d2f4vb1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vq1, d2f4vr1, d2f4vs1, d2f4vt1
   automatically matched to d1fjgc1
   complexed with ab9, d2c, k, mg, zn

Details for d2f4vc1

PDB Entry: 2f4v, 3.8 Å

PDB Description: 30S ribosome + designer antibiotic

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2f4vc1:

Sequence; same for both SEQRES and ATOM records:

>d2f4vc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

Timeline for d2f4vc1:

• d2f4vc1 first appeared in SCOP 1.73
  
• d2f4vc1 appears in SCOPe 2.02
  
• d2f4vc1 appears in SCOPe 2.04
  
• d2f4vc1 appears in the current release, SCOPe 2.08